SCOP 1.69: Domain d1ph4a1: 1ph4 A:36-204

Lineage for d1ph4a1 (1ph4 A:36-204)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
   barrel, closed; n=5, S=10

6. Protein Telomere end binding protein alpha subunit [50273] (1 species)
   duplication: consists of three domains of this fold

7. Species Oxytricha nova [TaxId:200597] [50274] (15 PDB entries)

8. Domain d1ph4a1: 1ph4 A:36-204 [88087]
   Other proteins in same PDB: d1ph4b_

Details for d1ph4a1

PDB Entry: 1ph4, 2.3 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttggcg

SCOP Domain Sequences for d1ph4a1:

Sequence; same for both SEQRES and ATOM records:

>d1ph4a1 b.40.4.3 (A:36-204) Telomere end binding protein alpha subunit {Oxytricha nova}
yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssys

Timeline for d1ph4a1:

• d1ph4a1 first appeared in SCOP 1.65
  
• d1ph4a1 appears in SCOP 1.67
  
• d1ph4a1 appears in SCOP 1.71
  
• d1ph4a1 appears in the current release, SCOPe 2.08