Lineage for d1ph1b_ (1ph1 B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559685Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) (S)
  5. 559752Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 559761Protein Core domain of telomere end binding protein beta subunit [50275] (1 species)
  7. 559762Species Oxytricha nova [TaxId:200597] [50276] (13 PDB entries)
  8. 559771Domain d1ph1b_: 1ph1 B: [88078]
    Other proteins in same PDB: d1ph1a1, d1ph1a2, d1ph1a3

Details for d1ph1b_

PDB Entry: 1ph1 (more details), 2.51 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttggggt

SCOP Domain Sequences for d1ph1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ph1b_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova}
pqqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkea
vnefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqe
rlnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvda
givkasaskgdefsdfsfkegntatlkiadifvqekg

SCOP Domain Coordinates for d1ph1b_:

Click to download the PDB-style file with coordinates for d1ph1b_.
(The format of our PDB-style files is described here.)

Timeline for d1ph1b_: