![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.1: RNI-like [52047] (3 families) ![]() regular structure consisting of similar repeats |
![]() | Family c.10.1.1: 28-residue LRR [52048] (2 proteins) this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain |
![]() | Protein Tropomodulin C-terminal domain [82322] (2 species) duplication: consists of 5 repeats |
![]() | Species nematode (Caenorhabditis elegans) [TaxId:6239] [89566] (1 PDB entry) |
![]() | Domain d1pgva_: 1pgv A: [88073] structural genomics |
PDB Entry: 1pgv (more details), 1.8 Å
SCOP Domain Sequences for d1pgva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans)} tdvescinrlreddtdlkevninnmkrvskerirslieaacnskhiekfslantaisdse arglielietspslrvlnvesnfltpellarllrstlvtqsivefkadnqrqsvlgnqve mdmmmaieenesllrvgisfasmearhrvsealernyervrlrrlgk
Timeline for d1pgva_: