Lineage for d1pgua2 (1pgu A:327-613)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1135268Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1135354Superfamily b.69.4: WD40 repeat-like [50978] (3 families) (S)
    also contains 8-bladed propellers
  5. 1135355Family b.69.4.1: WD40-repeat [50979] (11 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 1135356Protein Actin interacting protein 1 [89378] (2 species)
    14 repeats are arranged into two seven-bladed beta-propeller domains swapped with the N-terminal strands
  7. 1135357Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89380] (2 PDB entries)
  8. 1135359Domain d1pgua2: 1pgu A:327-613 [88070]
    complexed with zn

Details for d1pgua2

PDB Entry: 1pgu (more details), 2.3 Å

PDB Description: yeast actin interacting protein 1 (aip1), se-met protein, monoclinic crystal form
PDB Compounds: (A:) Actin interacting protein 1

SCOPe Domain Sequences for d1pgua2:

Sequence, based on SEQRES records: (download)

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ghdevlktisghnkgitaltvnplisgsydgrimewssssmhqdhsnlivsldnskaqey
ssiswddtlkvngitkhefgsqpkvasanndgftavltndddllilqsftgdiiksvrln
spgsavslsqnyvavgleegntiqvfklsdlevsfdlktplrakpsyisispsetyiaag
dvmgkillydlqsrevktsrwafrtskinaiswkpaekganeeeieedlvatgsldtnif
iysvkrpmkiikalnahkdgvnnllwetpstlvssgadacikrwnvv

Sequence, based on observed residues (ATOM records): (download)

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ghdevlktisghnkgitaltvnplisgsydgrimewssssmhqdhsnlivsldnskaqey
ssiswddtlkvngitkhefgsqpkvasanndgftavltndddllilqsftgdiiksvrln
spgsavslsqnyvavgleegntiqvfklsdlevsfdlktplrakpsyisispsetyiaag
dvmgkillydlqsrevktsrwafrtskinaiswkpaeeieedlvatgsldtnifiysvkr
pmkiikalnahkdgvnnllwetpstlvssgadacikrwnvv

SCOPe Domain Coordinates for d1pgua2:

Click to download the PDB-style file with coordinates for d1pgua2.
(The format of our PDB-style files is described here.)

Timeline for d1pgua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pgua1