Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (23 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein Multidrug resistance ABC transporter MsbA, C-terminal domain [89685] (2 species) a low-resolution structure of the E. coli MsbA in an open conformation is also available (f.35.1.1) a low-resolution structure of the E. coli MsbA in an open conformation is also available (f.35.1.1) |
Species Vibrio cholerae [TaxId:666] [89686] (1 PDB entry) |
Domain d1pf4d1: 1pf4 D:321-564 [88058] Other proteins in same PDB: d1pf4a2, d1pf4b2, d1pf4c2, d1pf4d2 structure in a closed conformation |
PDB Entry: 1pf4 (more details), 3.8 Å
SCOP Domain Sequences for d1pf4d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pf4d1 c.37.1.12 (D:321-564) Multidrug resistance ABC transporter MsbA, C-terminal domain {Vibrio cholerae [TaxId: 666]} lmdleterdngkyeaervngevdvkdvtftyqgkekpalshvsfsipqgktvalvgrsgs gkstianlftrfydvdsgsicldghdvrdykltnlrrhfalvsqnvhlfndtianniaya aegeytreqieqaarqahamefienmpqgldtvigengtslsggqrqrvaiarallrdap vlildeatsaldteseraiqaaldelqknktvlviahrlstieqadeilvvdegeiierg rhad
Timeline for d1pf4d1: