Lineage for d1pf4d1 (1pf4 D:321-564)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 831595Family c.37.1.12: ABC transporter ATPase domain-like [52686] (23 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 831751Protein Multidrug resistance ABC transporter MsbA, C-terminal domain [89685] (2 species)
    a low-resolution structure of the E. coli MsbA in an open conformation is also available (f.35.1.1)
    a low-resolution structure of the E. coli MsbA in an open conformation is also available (f.35.1.1)
  7. 831765Species Vibrio cholerae [TaxId:666] [89686] (1 PDB entry)
  8. 831769Domain d1pf4d1: 1pf4 D:321-564 [88058]
    Other proteins in same PDB: d1pf4a2, d1pf4b2, d1pf4c2, d1pf4d2
    structure in a closed conformation

Details for d1pf4d1

PDB Entry: 1pf4 (more details), 3.8 Å

PDB Description: Structure of MsbA from Vibrio cholera: A Multidrug Resistance ABC Transporter Homolog in a Closed Conformation
PDB Compounds: (D:) transport ATP-binding protein MsbA

SCOP Domain Sequences for d1pf4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pf4d1 c.37.1.12 (D:321-564) Multidrug resistance ABC transporter MsbA, C-terminal domain {Vibrio cholerae [TaxId: 666]}
lmdleterdngkyeaervngevdvkdvtftyqgkekpalshvsfsipqgktvalvgrsgs
gkstianlftrfydvdsgsicldghdvrdykltnlrrhfalvsqnvhlfndtianniaya
aegeytreqieqaarqahamefienmpqgldtvigengtslsggqrqrvaiarallrdap
vlildeatsaldteseraiqaaldelqknktvlviahrlstieqadeilvvdegeiierg
rhad

SCOP Domain Coordinates for d1pf4d1:

Click to download the PDB-style file with coordinates for d1pf4d1.
(The format of our PDB-style files is described here.)

Timeline for d1pf4d1: