Lineage for d1peva2 (1pev A:313-611)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2808918Family b.69.4.1: WD40-repeat [50979] (17 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 2808919Protein Actin interacting protein 1 [89378] (2 species)
    14 repeats are arranged into two seven-bladed beta-propeller domains swapped with the N-terminal strands
  7. 2808927Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89379] (2 PDB entries)
  8. 2808931Domain d1peva2: 1pev A:313-611 [88048]

Details for d1peva2

PDB Entry: 1pev (more details), 2 Å

PDB Description: crystal structure of the actin interacting protein from caenorhabditis elegans
PDB Compounds: (A:) Actin interacting protein 1

SCOPe Domain Sequences for d1peva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1peva2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
lgsidqvryghnkaitalsssadgktlfsadaeghinswdistgisnrvfpdvhatmitg
ikttskgdlftvswddhlkvvpaggsgvdsskavanklssqplglavsadgdiavaacyk
hiaiyshgkltevpisynsscvalsndkqfvavggqdskvhvyklsgasvsevktivhpa
eitsvafsnngaflvatdqsrkvipysvannfelahtnswtfhtakvacvswspdnvrla
tgsldnsvivwnmnkpsdhpiiikgahamssvnsviwlnettivsagqdsnikfwnvpf

SCOPe Domain Coordinates for d1peva2:

Click to download the PDB-style file with coordinates for d1peva2.
(The format of our PDB-style files is described here.)

Timeline for d1peva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1peva1