SCOPe 2.01: Domain d1peva1: 1pev A:2-312

Lineage for d1peva1 (1pev A:2-312)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (3 families)
   also contains 8-bladed propellers

5. Family b.69.4.1: WD40-repeat [50979] (11 proteins)
   this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain

6. Protein Actin interacting protein 1 [89378] (2 species)
   14 repeats are arranged into two seven-bladed beta-propeller domains swapped with the N-terminal strands

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89379] (2 PDB entries)

8. Domain d1peva1: 1pev A:2-312 [88047]

Details for d1peva1

PDB Entry: 1pev, 2 Å

PDB Description: crystal structure of the actin interacting protein from caenorhabditis elegans

PDB Compounds: (A:) Actin interacting protein 1

SCOPe Domain Sequences for d1peva1:

Sequence; same for both SEQRES and ATOM records:

>d1peva1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
sefsqtalfpslprtargtavvlgntpagdkiqycngtsvytvpvgsltdteiytehshq
ttvaktspsgyycasgdvhgnvriwdttqtthilkttipvfsgpvkdiswdseskriaav
gegrerfghvflfdtgtsngnltgqaramnsvdfkpsrpfriisgsddntvaifegppfk
fkstfgehtkfvhsvrynpdgslfastggdgtivlyngvdgtktgvfeddslknvahsgs
vfgltwspdgtkiasasadktikiwnvatlkvektipvgtriedqqlgiiwtkqalvsis
angfinfvnpe

Timeline for d1peva1:

• d1peva1 first appeared in SCOP 1.65
  
• d1peva1 appears in SCOP 1.75
  
• d1peva1 appears in SCOPe 2.02
  
• d1peva1 appears in the current release, SCOPe 2.08