Lineage for d1pdub_ (1pdu B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 285381Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 285382Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 285383Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (25 proteins)
  6. 285446Protein Nuclear hormone receptor HR38 [89144] (1 species)
  7. 285447Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89145] (1 PDB entry)
  8. 285449Domain d1pdub_: 1pdu B: [88035]

Details for d1pdub_

PDB Entry: 1pdu (more details), 2.3 Å

PDB Description: Ligand-binding domain of Drosophila orphan nuclear receptor DHR38

SCOP Domain Sequences for d1pdub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdub_ a.123.1.1 (B:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster)}
islitalvrshvdttpdpscldyshyeeqsmseadkvqqfyqlltssvdvikqfaekipg
yfdllpedqellfqsaslelfvlrlayrariddtklifcngtvlhrtqclrsfgewlndi
mefsrslhnleidisafaclcaltliterhglrepkkveqlqmkiigslrdhvtynaeaq
kkqhyfsrllgklpelrslsvqglqrifylkledlvpapalienmfvt

SCOP Domain Coordinates for d1pdub_:

Click to download the PDB-style file with coordinates for d1pdub_.
(The format of our PDB-style files is described here.)

Timeline for d1pdub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pdua_