Lineage for d1pc1.2 (1pc1 D:,C:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341324Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulphide-rich
  4. 341325Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 341326Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 341331Protein Insulin [56996] (3 species)
  7. 341341Species Human (Homo sapiens) [TaxId:9606] [56998] (56 PDB entries)
  8. 341405Domain d1pc1.2: 1pc1 D:,C: [88032]
    complexed with iil, iph, zn

Details for d1pc1.2

PDB Entry: 1pc1 (more details), 2 Å

PDB Description: Crystal structure of Allo-IleA2-insulin, an inactive chiral analogue: Implications for the Mechanism of Receptor Binding

SCOP Domain Sequences for d1pc1.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1pc1.2 g.1.1.1 (D:,C:) Insulin {Human (Homo sapiens)}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1pc1.2:

Click to download the PDB-style file with coordinates for d1pc1.2.
(The format of our PDB-style files is described here.)

Timeline for d1pc1.2:

  • d1pc1.2 is new in SCOP 1.65
  • d1pc1.2 became obsolete in SCOP 1.67