Lineage for d1pb6a1 (1pb6 A:14-85)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438100Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 438358Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (9 proteins)
  6. 438368Protein Hypothetical transcriptional regulator YcdC [88973] (1 species)
  7. 438369Species Escherichia coli [TaxId:562] [88974] (1 PDB entry)
  8. 438370Domain d1pb6a1: 1pb6 A:14-85 [88017]
    Other proteins in same PDB: d1pb6a2, d1pb6b2, d1pb6c2, d1pb6d2

Details for d1pb6a1

PDB Entry: 1pb6 (more details), 2.5 Å

PDB Description: Crystal structure of hypothetical transcriptional regulator ycdC

SCOP Domain Sequences for d1pb6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pb6a1 a.4.1.9 (A:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli}
avsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqil
diwlaplkafre

SCOP Domain Coordinates for d1pb6a1:

Click to download the PDB-style file with coordinates for d1pb6a1.
(The format of our PDB-style files is described here.)

Timeline for d1pb6a1: