Class b: All beta proteins [48724] (126 folds) |
Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (9 proteins) barrel, closed; n=5, S=10 |
Protein Telomere end binding protein alpha subunit [50273] (1 species) duplication: consists of three domains of this fold |
Species Oxytricha nova [TaxId:200597] [50274] (15 PDB entries) |
Domain d1pa6a1: 1pa6 A:36-204 [88009] Other proteins in same PDB: d1pa6b_ |
PDB Entry: 1pa6 (more details), 2.45 Å
SCOP Domain Sequences for d1pa6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pa6a1 b.40.4.3 (A:36-204) Telomere end binding protein alpha subunit {Oxytricha nova} yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssys
Timeline for d1pa6a1: