Lineage for d1p9va1 (1p9v A:2-140)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327140Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 327141Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (2 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 327149Family d.21.1.2: PhzC/PhzF-like [89863] (1 protein)
  6. 327150Protein Hypothetical protein YddE [89864] (1 species)
  7. 327151Species Escherichia coli [TaxId:562] [89865] (1 PDB entry)
  8. 327152Domain d1p9va1: 1p9v A:2-140 [88007]

Details for d1p9va1

PDB Entry: 1p9v (more details), 2.3 Å

PDB Description: x-ray structure of ydde_ecoli northeast structural genomics consortium target et25.

SCOP Domain Sequences for d1p9va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9va1 d.21.1.2 (A:2-140) Hypothetical protein YddE {Escherichia coli}
sgrenlyfqghmkpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetaf
llhsddsdvriryftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiek
hnddyrisleqgtpgfepp

SCOP Domain Coordinates for d1p9va1:

Click to download the PDB-style file with coordinates for d1p9va1.
(The format of our PDB-style files is described here.)

Timeline for d1p9va1:

  • d1p9va1 is new in SCOP 1.65
  • d1p9va1 became obsolete in SCOP 1.67

View in 3D
Domains from same chain:
(mouse over for more information)
d1p9va2