Lineage for d1p9ue_ (1p9u E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797364Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
    contains an extra alpha-helical domain
  7. 2797911Species Transmissible gastroenteritis virus [TaxId:11149] [74980] (3 PDB entries)
  8. 2797922Domain d1p9ue_: 1p9u E: [88005]
    complexed with mrd, so4
    has additional subdomain(s) that are not in the common domain

Details for d1p9ue_

PDB Entry: 1p9u (more details), 2.37 Å

PDB Description: coronavirus main proteinase (3clpro) structure: basis for design of anti-sars drugs
PDB Compounds: (E:) putative coronavirus nsp2 (3CL-PRO)

SCOPe Domain Sequences for d1p9ue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9ue_ b.47.1.4 (E:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Transmissible gastroenteritis virus [TaxId: 11149]}
sglrkmaqpsglvepcivrvsygnnvlnglwlgdevicprhviasdttrvinyenemssv
rlhnfsvsknnvflgvvsarykgvnlvlkvnqvnpntpehkfksikagesfnilacyegc
pgsvygvnmrsqgtikgsfiagtcgsvgyvlengilyfvymhhlelgngshvgsnfegem
yggyedqpsmqlegtnvmssdnvvaflyaalingerwfvtntsmslesyntwaktnsfte
lsstdafsmlaaktgqsveklldsivrlnkgfggrtilsygslcdeftptevirqmygv

SCOPe Domain Coordinates for d1p9ue_:

Click to download the PDB-style file with coordinates for d1p9ue_.
(The format of our PDB-style files is described here.)

Timeline for d1p9ue_: