![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins) |
![]() | Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (3 species) contains an extra alpha-helical domain |
![]() | Species Human coronavirus 229E [TaxId:11137] [89348] (1 PDB entry) |
![]() | Domain d1p9sb_: 1p9s B: [88000] complexed with dox, mse; mutant |
PDB Entry: 1p9s (more details), 2.54 Å
SCOP Domain Sequences for d1p9sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p9sb_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus 229E [TaxId: 11137]} aglrkmaqpsgfvekcvvrvcygntvlnglwlgdivycprhviasnttsaidydheysim rlhnfsiisgtaflgvvgatmhgvtlkikvsqtnmhtprhsfrtlksgegfnilacydgc aqgvfgvnmrtnwtirgsfingacgspgynlkngevefvymhqielgsgshvgssfdgvm yggfedqpnlqvesanqmltvnvvaflyaailngctwwlkgeklfvehynewaqangfta mngedafsilaaktgvcverllhaiqvlnngfggkqilgysslndefsinevvkqmfgv
Timeline for d1p9sb_: