SCOP 1.65: Domain d1p9mc1: 1p9m C:96-195

Lineage for d1p9mc1 (1p9m C:96-195)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (20 proteins)

6. Protein Interleukin-6 receptor alpha chain, domains 2 and 3 [81977] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81978] (2 PDB entries)

8. Domain d1p9mc1: 1p9m C:96-195 [87995]
   Other proteins in same PDB: d1p9ma1, d1p9ma2, d1p9ma3, d1p9mb_

Details for d1p9mc1

PDB Entry: 1p9m, 3.65 Å

PDB Description: Crystal structure of the hexameric human IL-6/IL-6 alpha receptor/gp130 complex

SCOP Domain Sequences for d1p9mc1:

Sequence; same for both SEQRES and ATOM records:

>d1p9mc1 b.1.2.1 (C:96-195) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens)}
eepqlscfrksplsnvvcewgprstpslttkavllvrkfqnspaedfqepcqysqesqkf
scqlavpegdssfyivsmcvassvgskfsktqtfqgcgil

Timeline for d1p9mc1:

• d1p9mc1 is new in SCOP 1.65
  
• d1p9mc1 appears in SCOP 1.67
  
• d1p9mc1 appears in the current release, SCOPe 2.08