Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries) |
Domain d1p9ma2: 1p9m A:102-196 [87992] Other proteins in same PDB: d1p9mb_, d1p9mc1, d1p9mc2 |
PDB Entry: 1p9m (more details), 3.65 Å
SCOPe Domain Sequences for d1p9ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p9ma2 b.1.2.1 (A:102-196) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} lppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdtptsct vdystvyfvnievwveaenalgkvtsdhinfdpvy
Timeline for d1p9ma2: