SCOPe 2.07: Domain d1p8va1: 1p8v A:1-278

Lineage for d1p8va1 (1p8v A:1-278)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
   this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain

6. Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75144] (10 PDB entries)

8. Domain d1p8va1: 1p8v A:1-278 [87985]
   Other proteins in same PDB: d1p8v.1, d1p8va2
   complexed with dfp, mes, nag

Details for d1p8va1

PDB Entry: 1p8v, 2.6 Å

PDB Description: crystal structure of the complex of platelet receptor gpib-alpha and alpha-thrombin at 2.6a

PDB Compounds: (A:) platelet glycoprotein ib alpha chain

SCOPe Domain Sequences for d1p8va1:

Sequence; same for both SEQRES and ATOM records:

>d1p8va1 c.10.2.7 (A:1-278) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}
hpicevskvashlevncdkrdltalppdlpkdttilhlsenllytfslatlmpytrltql
nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannnltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
snvasvqcdnsdkfpvykypgkgcptlgdegdtdlydy

Timeline for d1p8va1:

• d1p8va1 first appeared in SCOP 1.65, called d1p8va_
  
• d1p8va1 appears in SCOPe 2.06
  
• d1p8va1 appears in the current release, SCOPe 2.08