Lineage for d1p85a_ (1p85 A:)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2268317Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2268318Protein 70S ribosome functional complex [58121] (4 species)
  7. 2268319Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 2268491Domain d1p85a_: 1p85 A: [87870]
    50S subunit fit in the cryo-EM map of 70S ribosome

Details for d1p85a_

PDB Entry: 1p85 (more details), 12.3 Å

PDB Description: Real space refined coordinates of the 50S subunit fitted into the low resolution cryo-EM map of the EF-G.GTP state of E. coli 70S ribosome
PDB Compounds: (A:) 50S ribosomal protein L2

SCOPe Domain Sequences for d1p85a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p85a_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
ksggrnnngrittrhiggghkqayrivdfkrnkdgipavverleydpnrsanialvlykd
gerryilapkglkagdqiqsgvdaaikpgntlpmrnipvgstvhnvemkpgkggqlarsa
gtyvqivardgayvtlrlrsgemrkveadcratlgevgnaehmlrvlgkagaarwrgvrp
tvrgtamnpvdhphgggegrnfgkhpvtpwgvqtkgkktrsnkrtdk

SCOPe Domain Coordinates for d1p85a_:

Click to download the PDB-style file with coordinates for d1p85a_.
(The format of our PDB-style files is described here.)

Timeline for d1p85a_: