![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
![]() | Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) ![]() location - intermembrane side of the bc1 complex automatically mapped to Pfam PF02320 |
![]() | Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
![]() | Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81528] (6 PDB entries) |
![]() | Domain d1p84f_: 1p84 F: [87860] Other proteins in same PDB: d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84c1, d1p84c2, d1p84d1, d1p84d2, d1p84e1, d1p84e2, d1p84g_, d1p84h_, d1p84i_, d1p84j_, d1p84k_ complexed with 3pe, 3ph, cdl, dbt, fes, hem, pc1, umq, uq6 |
PDB Entry: 1p84 (more details), 2.5 Å
SCOPe Domain Sequences for d1p84f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p84f_ f.28.1.1 (F:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy ldtataprlfdklk
Timeline for d1p84f_: