Details for d1p84e2

PDB Entry: 1p84 (more details), 2.5 Å

PDB Description: hdbt inhibited yeast cytochrome bc1 complex

SCOP Domain Sequences for d1p84e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p84e2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae)}
kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata

SCOP Domain Coordinates for d1p84e2:

Click to download the PDB-style file with coordinates for d1p84e2.
(The format of our PDB-style files is described here.)

Timeline for d1p84e2: