SCOPe 2.06: Domain d1p84c2: 1p84 C:1-261

Lineage for d1p84c2 (1p84 C:1-261)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
   also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81640] (5 PDB entries)

8. Domain d1p84c2: 1p84 C:1-261 [87855]
   Other proteins in same PDB: d1p84a1, d1p84a2, d1p84b1, d1p84b2, d1p84c1, d1p84d1, d1p84d2, d1p84e1, d1p84e2, d1p84f_, d1p84g_, d1p84h_, d1p84i_, d1p84j_, d1p84k_
   complexed with 3pe, 3ph, cdl, dbt, fes, hem, pc1, umq, uq6

Details for d1p84c2

PDB Entry: 1p84, 2.5 Å

PDB Description: hdbt inhibited yeast cytochrome bc1 complex

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1p84c2:

Sequence; same for both SEQRES and ATOM records:

>d1p84c2 f.21.1.2 (C:1-261) Mitochondrial cytochrome b subunit, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel
afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii
ftltiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff
alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil
alfvfyspntlghpdnyipgn

Timeline for d1p84c2:

• d1p84c2 first appeared in SCOP 1.65
  
• d1p84c2 appears in SCOPe 2.05
  
• d1p84c2 appears in SCOPe 2.07
  
• d1p84c2 appears in the current release, SCOPe 2.08