SCOP 1.69: Domain d1p84b2: 1p84 B:219-368

Lineage for d1p84b2 (1p84 B:219-368)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (4 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64305] (4 PDB entries)

8. Domain d1p84b2: 1p84 B:219-368 [87853]
   Other proteins in same PDB: d1p84a1, d1p84a2, d1p84c1, d1p84c2, d1p84d1, d1p84d2, d1p84e1, d1p84e2, d1p84f_, d1p84g_, d1p84h_, d1p84i_, d1p84j_, d1p84k_

Details for d1p84b2

PDB Entry: 1p84, 2.5 Å

PDB Description: hdbt inhibited yeast cytochrome bc1 complex

SCOP Domain Sequences for d1p84b2:

Sequence; same for both SEQRES and ATOM records:

>d1p84b2 d.185.1.1 (B:219-368) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae)}
sepkfflgeenrvrfigdsvaaigipvnkaslaqyevlanyltsalselsglissakldk
ftdgglftlfvrdqdsavvssnikkivadlkkgkdlspainytklknavqnesvsspiel
nfdavkdfklgkfnyvavgdvsnlpyldel

Timeline for d1p84b2:

• d1p84b2 first appeared in SCOP 1.65
  
• d1p84b2 appears in SCOP 1.67
  
• d1p84b2 appears in SCOP 1.71
  
• d1p84b2 appears in the current release, SCOPe 2.08