![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (4 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein Cytochrome bc1 core subunit 2 [63409] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64305] (4 PDB entries) |
![]() | Domain d1p84b2: 1p84 B:219-368 [87853] Other proteins in same PDB: d1p84a1, d1p84a2, d1p84c1, d1p84c2, d1p84d1, d1p84d2, d1p84e1, d1p84e2, d1p84f_, d1p84g_, d1p84h_, d1p84i_, d1p84j_, d1p84k_ complexed with 3pe, 3ph, cdl, dbt, fes, hem, pc1, umq, uq6 |
PDB Entry: 1p84 (more details), 2.5 Å
SCOP Domain Sequences for d1p84b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p84b2 d.185.1.1 (B:219-368) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae)} sepkfflgeenrvrfigdsvaaigipvnkaslaqyevlanyltsalselsglissakldk ftdgglftlfvrdqdsavvssnikkivadlkkgkdlspainytklknavqnesvsspiel nfdavkdfklgkfnyvavgdvsnlpyldel
Timeline for d1p84b2: