SCOP 1.73: Domain d1p7bb2: 1p7b B:36-151

Lineage for d1p7bb2 (1p7b B:36-151)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)

6. Protein Inward rectifier potassium channel Kirbac1.1 [90109] (1 species)

7. Species Burkholderia pseudomallei [TaxId:28450] [90110] (1 PDB entry)

8. Domain d1p7bb2: 1p7b B:36-151 [87847]
   Other proteins in same PDB: d1p7ba1, d1p7bb1
   complexed with k

Details for d1p7bb2

PDB Entry: 1p7b, 3.65 Å

PDB Description: Crystal structure of an inward rectifier potassium channel

PDB Compounds: (B:) integral membrane channel and cytosolic domains

SCOP Domain Sequences for d1p7bb2:

Sequence; same for both SEQRES and ATOM records:

>d1p7bb2 f.14.1.1 (B:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]}
reviaygmpasvwrdlyywalkvswpvffaslaalfvvnntlfallyqlgdapianqspp
gfvgafffsvetlatvgygdmhpqtvyahaiatleifvgmsgialstglvfarfar

Timeline for d1p7bb2:

• d1p7bb2 first appeared in SCOP 1.65
  
• d1p7bb2 appears in SCOP 1.71
  
• d1p7bb2 appears in SCOP 1.75
  
• d1p7bb2 appears in the current release, SCOPe 2.08