Lineage for d1p7ba1 (1p7b A:152-309)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456598Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (2 proteins)
  6. 456602Protein Inward rectifier potassium channel Kirbac1.1 [89195] (1 species)
  7. 456603Species Burkholderia pseudomallei [TaxId:28450] [89196] (1 PDB entry)
  8. 456604Domain d1p7ba1: 1p7b A:152-309 [87844]
    Other proteins in same PDB: d1p7ba2, d1p7bb2

Details for d1p7ba1

PDB Entry: 1p7b (more details), 3.65 Å

PDB Description: Crystal structure of an inward rectifier potassium channel

SCOP Domain Sequences for d1p7ba1:

Sequence, based on SEQRES records: (download)

>d1p7ba1 b.1.18.16 (A:152-309) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei}
prakimfarhaivrpfngrmtlmvraanarqnviaearakmrlmrrehssegyslmkihd
lklvrnehpifllgwnmmhvidessplfgetpeslaegramllvmiegsdettaqvmqar
hawehddirwhhryvdlmsdvdgmthidytrfndtepv

Sequence, based on observed residues (ATOM records): (download)

>d1p7ba1 b.1.18.16 (A:152-309) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei}
prakimfarhaivrpfngrmtlmvraanarqnviaearakmrlmlmkihdlklvrnehpi
fllgwnmmhvidessplfgetpeslaegramllvmiegsdettaqvmqarhawehddirw
hhryvdlmthidytrfndtepv

SCOP Domain Coordinates for d1p7ba1:

Click to download the PDB-style file with coordinates for d1p7ba1.
(The format of our PDB-style files is described here.)

Timeline for d1p7ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p7ba2