Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins) |
Protein Inward rectifier potassium channel Kirbac1.1 [89195] (1 species) |
Species Burkholderia pseudomallei [TaxId:28450] [89196] (1 PDB entry) |
Domain d1p7ba1: 1p7b A:152-309 [87844] Other proteins in same PDB: d1p7ba2, d1p7bb2 complexed with k |
PDB Entry: 1p7b (more details), 3.65 Å
SCOPe Domain Sequences for d1p7ba1:
Sequence, based on SEQRES records: (download)
>d1p7ba1 b.1.18.16 (A:152-309) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} prakimfarhaivrpfngrmtlmvraanarqnviaearakmrlmrrehssegyslmkihd lklvrnehpifllgwnmmhvidessplfgetpeslaegramllvmiegsdettaqvmqar hawehddirwhhryvdlmsdvdgmthidytrfndtepv
>d1p7ba1 b.1.18.16 (A:152-309) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} prakimfarhaivrpfngrmtlmvraanarqnviaearakmrlmlmkihdlklvrnehpi fllgwnmmhvidessplfgetpeslaegramllvmiegsdettaqvmqarhawehddirw hhryvdlmthidytrfndtepv
Timeline for d1p7ba1: