| Class i: Low resolution protein structures [58117] (26 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
| Protein 70S ribosome functional complex [58121] (9 species) |
| Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
| Domain d1p6gr_: 1p6g R: [87836] 30S subunit fit in the cryo-EM map of 70S ribosome |
PDB Entry: 1p6g (more details), 12.3 Å
SCOP Domain Sequences for d1p6gr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p6gr_ i.1.1.1 (R:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
qeidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllp
Timeline for d1p6gr_: