Lineage for d1p6gl_ (1p6g L:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896398Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 896533Domain d1p6gl_: 1p6g L: [87830]
    30S subunit fit in the cryo-EM map of 70S ribosome

Details for d1p6gl_

PDB Entry: 1p6g (more details), 12.3 Å

PDB Description: Real space refined coordinates of the 30S subunit fitted into the low resolution cryo-EM map of the EF-G.GTP state of E. coli 70S ribosome
PDB Compounds: (L:) 30S ribosomal protein S12

SCOP Domain Sequences for d1p6gl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6gl_ i.1.1.1 (L:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
pqkrgvctrvytttpkkpnsalrkvcrvrltngfevtsyiggeghnlqehsvilirggrv
kdlpgvryhtvrgaldcsgvkdrkqarskygvkrpka

SCOP Domain Coordinates for d1p6gl_:

Click to download the PDB-style file with coordinates for d1p6gl_.
(The format of our PDB-style files is described here.)

Timeline for d1p6gl_: