Lineage for d1p6gf_ (1p6g F:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2647135Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2647136Protein 70S ribosome functional complex [58121] (4 species)
  7. 2647137Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 2647291Domain d1p6gf_: 1p6g F: [87824]
    30S subunit fit in the cryo-EM map of 70S ribosome

Details for d1p6gf_

PDB Entry: 1p6g (more details), 12.3 Å

PDB Description: Real space refined coordinates of the 30S subunit fitted into the low resolution cryo-EM map of the EF-G.GTP state of E. coli 70S ribosome
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1p6gf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6gf_ i.1.1.1 (F:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
lmnveapqevidelettfrfndavirsmvmrtkha

SCOPe Domain Coordinates for d1p6gf_:

Click to download the PDB-style file with coordinates for d1p6gf_.
(The format of our PDB-style files is described here.)

Timeline for d1p6gf_: