SCOPe 2.02: Domain d1p4ob_: 1p4o B:

Lineage for d1p4ob_ (1p4o B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Insulin-like growth factor 1 receptor [69825] (1 species)
   PTK group; InsR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [69826] (15 PDB entries)

8. Domain d1p4ob_: 1p4o B: [87776]

Details for d1p4ob_

PDB Entry: 1p4o, 1.5 Å

PDB Description: structure of apo unactivated igf-1r kinase domain at 1.5a resolution.

PDB Compounds: (B:) Insulin-like growth factor I receptor protein

SCOPe Domain Sequences for d1p4ob_:

Sequence; same for both SEQRES and ATOM records:

>d1p4ob_ d.144.1.7 (B:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
npeyfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvn
eaasmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrp
amannpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgm
trdiyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqgl
sneqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfre
vsfyyseenklpep

Timeline for d1p4ob_:

• d1p4ob_ first appeared in SCOP 1.65
  
• d1p4ob_ appears in SCOPe 2.01
  
• d1p4ob_ appears in SCOPe 2.03
  
• d1p4ob_ appears in the current release, SCOPe 2.08