Lineage for d1p4oa_ (1p4o A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2588271Protein Insulin-like growth factor 1 receptor [69825] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 2588272Species Human (Homo sapiens) [TaxId:9606] [69826] (18 PDB entries)
  8. 2588273Domain d1p4oa_: 1p4o A: [87775]

Details for d1p4oa_

PDB Entry: 1p4o (more details), 1.5 Å

PDB Description: structure of apo unactivated igf-1r kinase domain at 1.5a resolution.
PDB Compounds: (A:) Insulin-like growth factor I receptor protein

SCOPe Domain Sequences for d1p4oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
peyfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvne
aasmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpa
mannpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmt
rdiyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqgls
neqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrev
sfyyseen

SCOPe Domain Coordinates for d1p4oa_:

Click to download the PDB-style file with coordinates for d1p4oa_.
(The format of our PDB-style files is described here.)

Timeline for d1p4oa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p4ob_