Lineage for d1p4oa_ (1p4o A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611837Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 611838Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 611879Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 612265Protein Insulin-like growth factor 1 receptor [69825] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 612266Species Human (Homo sapiens) [TaxId:9606] [69826] (4 PDB entries)
  8. 612267Domain d1p4oa_: 1p4o A: [87775]

Details for d1p4oa_

PDB Entry: 1p4o (more details), 1.5 Å

PDB Description: Structure of Apo unactivated IGF-1R KInase domain at 1.5A resolution.

SCOP Domain Sequences for d1p4oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens)}
peyfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvne
aasmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpa
mannpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmt
rdiyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqgls
neqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrev
sfyyseen

SCOP Domain Coordinates for d1p4oa_:

Click to download the PDB-style file with coordinates for d1p4oa_.
(The format of our PDB-style files is described here.)

Timeline for d1p4oa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p4ob_