Lineage for d1p3hl_ (1p3h L:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2394951Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2394952Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2394953Family b.35.1.1: GroES [50130] (2 proteins)
    automatically mapped to Pfam PF00166
  6. 2394954Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 2395013Species Mycobacterium tuberculosis [TaxId:1773] [63753] (3 PDB entries)
  8. 2395036Domain d1p3hl_: 1p3h L: [87745]
    complexed with ca, mpd

Details for d1p3hl_

PDB Entry: 1p3h (more details), 2.8 Å

PDB Description: crystal structure of the mycobacterium tuberculosis chaperonin 10 tetradecamer
PDB Compounds: (L:) 10 kda chaperonin

SCOPe Domain Sequences for d1p3hl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3hl_ b.35.1.1 (L:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]}
kvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripld
vaegdtviyskyggteikyngeeylilsardvlavvsk

SCOPe Domain Coordinates for d1p3hl_:

Click to download the PDB-style file with coordinates for d1p3hl_.
(The format of our PDB-style files is described here.)

Timeline for d1p3hl_: