SCOPe 2.02: Domain d1p22b1: 1p22 B:64-136

Lineage for d1p22b1 (1p22 B:64-136)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family)

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins)

6. Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81376] (8 PDB entries)

8. Domain d1p22b1: 1p22 B:64-136 [87717]
   Other proteins in same PDB: d1p22a1, d1p22a2, d1p22b2

Details for d1p22b1

PDB Entry: 1p22, 2.95 Å

PDB Description: Structure of a beta-TrCP1-Skp1-beta-catenin complex: destruction motif binding and lysine specificity on the SCFbeta-TrCP1 ubiquitin ligase

PDB Compounds: (B:) skp1

SCOPe Domain Sequences for d1p22b1:

Sequence; same for both SEQRES and ATOM records:

>d1p22b1 a.157.1.1 (B:64-136) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrken

Timeline for d1p22b1:

• d1p22b1 first appeared in SCOP 1.65
  
• d1p22b1 appears in SCOPe 2.01
  
• d1p22b1 appears in SCOPe 2.03
  
• d1p22b1 appears in the current release, SCOPe 2.08