Lineage for d1p22b1 (1p22 B:64-136)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 926946Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 926947Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family) (S)
  5. 926948Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins)
  6. 926953Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)
  7. 926954Species Human (Homo sapiens) [TaxId:9606] [81376] (8 PDB entries)
  8. 926970Domain d1p22b1: 1p22 B:64-136 [87717]
    Other proteins in same PDB: d1p22a1, d1p22a2, d1p22b2

Details for d1p22b1

PDB Entry: 1p22 (more details), 2.95 Å

PDB Description: Structure of a beta-TrCP1-Skp1-beta-catenin complex: destruction motif binding and lysine specificity on the SCFbeta-TrCP1 ubiquitin ligase
PDB Compounds: (B:) skp1

SCOPe Domain Sequences for d1p22b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p22b1 a.157.1.1 (B:64-136) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrken

SCOPe Domain Coordinates for d1p22b1:

Click to download the PDB-style file with coordinates for d1p22b1.
(The format of our PDB-style files is described here.)

Timeline for d1p22b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p22b2