| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family) ![]() |
| Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins) |
| Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [81376] (8 PDB entries) |
| Domain d1p22b1: 1p22 B:64-136 [87717] Other proteins in same PDB: d1p22a1, d1p22a2, d1p22b2 |
PDB Entry: 1p22 (more details), 2.95 Å
SCOPe Domain Sequences for d1p22b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p22b1 a.157.1.1 (B:64-136) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrken
Timeline for d1p22b1: