| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.158: F-box domain [81385] (1 superfamily) multihelical; interlocked heterodimer with the Skp1 dimerisation domain |
Superfamily a.158.1: F-box domain [81383] (1 family) ![]() |
| Family a.158.1.1: F-box domain [81381] (4 proteins) |
| Protein F-box/WD-repeat protein 1 (beta-TRCP1) [89138] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89139] (1 PDB entry) |
| Domain d1p22a1: 1p22 A:135-252 [87715] Other proteins in same PDB: d1p22a2, d1p22b1, d1p22b2 complexed with sep |
PDB Entry: 1p22 (more details), 2.95 Å
SCOP Domain Sequences for d1p22a1:
Sequence, based on SEQRES records: (download)
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}
spaimlqrdfitalpargldhiaenilsyldakslcaaelvckewyrvtsdgmlwkklie
rmvrtdslwrglaerrgwgqylfknkppdgnappnsfyralypkiiqdietiesnwrc
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}
spaimlqrdfitalpargldhiaenilsyldakslcaaelvckewyrvtsdgmlwkklie
rmvrtdslwrglaerrgwgqylfppnsfyralypkiiqdietiesnwrc
Timeline for d1p22a1: