Lineage for d1p1ka2 (1p1k A:323-437)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203521Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2203603Protein Myo-inositol 1-phosphate synthase [75484] (4 species)
  7. 2203611Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (9 PDB entries)
    Uniprot P11986
  8. 2203620Domain d1p1ka2: 1p1k A:323-437 [87692]
    Other proteins in same PDB: d1p1ka1, d1p1kb1
    complexed with nai

Details for d1p1ka2

PDB Entry: 1p1k (more details), 2.1 Å

PDB Description: Crystal structure of the 1L-myo-inositol 1-phosphate synthase complexed with NADH in the presence of EDTA
PDB Compounds: (A:) Inositol-3-phosphate synthase

SCOPe Domain Sequences for d1p1ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1ka2 d.81.1.3 (A:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia
sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

SCOPe Domain Coordinates for d1p1ka2:

Click to download the PDB-style file with coordinates for d1p1ka2.
(The format of our PDB-style files is described here.)

Timeline for d1p1ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p1ka1