Lineage for d1p1ja1 (1p1j A:9-322,A:438-533)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1829130Protein Myo-inositol 1-phosphate synthase [75105] (4 species)
  7. 1829138Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75107] (9 PDB entries)
    Uniprot P11986
  8. 1829139Domain d1p1ja1: 1p1j A:9-322,A:438-533 [87687]
    Other proteins in same PDB: d1p1ja2, d1p1jb2
    complexed with gol, nai, po4

Details for d1p1ja1

PDB Entry: 1p1j (more details), 1.7 Å

PDB Description: Crystal structure of the 1L-myo-inositol 1-phosphate synthase complexed with NADH
PDB Compounds: (A:) Inositol-3-phosphate synthase

SCOPe Domain Sequences for d1p1ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1ja1 c.2.1.3 (A:9-322,A:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
itsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgi
mliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvya
pfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyyp
dfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtante
ryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvql
aehegtfiagddlkXdsllatpliidllvmtefctrvsykkvdpvkedagkfenfypvlt
flsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll

SCOPe Domain Coordinates for d1p1ja1:

Click to download the PDB-style file with coordinates for d1p1ja1.
(The format of our PDB-style files is described here.)

Timeline for d1p1ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p1ja2