Lineage for d1p0fb1 (1p0f B:2001-2163,B:2338-2372)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558060Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 558061Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 558147Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 558165Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 558188Species Frog (Rana perezi) [TaxId:8403] [89305] (2 PDB entries)
  8. 558192Domain d1p0fb1: 1p0f B:2001-2163,B:2338-2372 [87644]
    Other proteins in same PDB: d1p0fa2, d1p0fb2
    complexed with cry, nap, zn

Details for d1p0fb1

PDB Entry: 1p0f (more details), 1.8 Å

PDB Description: Crystal Structure of the Binary Complex: NADP(H)-Dependent Vertebrate Alcohol Dehydrogenase (ADH8) with the cofactor NADP

SCOP Domain Sequences for d1p0fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p0fb1 b.35.1.2 (B:2001-2163,B:2338-2372) Alcohol dehydrogenase {Frog (Rana perezi)}
ctagkditckaavawephkplsletitvappkahevrikilasgicgsdssvlkeiipsk
fpvilgheavgvvesigagvtcvkpgdkviplfvpqcgscrackssnsnfcekndmgakt
glmadmtsrftcrgkpiynlmgtstfteytvvadiavakidpkXinvnflvstkltldqi
nkafellssgqgvrsimiy

SCOP Domain Coordinates for d1p0fb1:

Click to download the PDB-style file with coordinates for d1p0fb1.
(The format of our PDB-style files is described here.)

Timeline for d1p0fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p0fb2