Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (14 proteins) N-terminal all-beta domain defines family |
Protein Alcohol dehydrogenase [51737] (9 species) |
Species Frog (Rana perezi) [TaxId:8403] [89511] (2 PDB entries) |
Domain d1p0cb2: 1p0c B:2164-2337 [87641] Other proteins in same PDB: d1p0ca1, d1p0cb1 |
PDB Entry: 1p0c (more details), 2.2 Å
SCOP Domain Sequences for d1p0cb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p0cb2 c.2.1.1 (B:2164-2337) Alcohol dehydrogenase {Frog (Rana perezi)} aplescligcgfatgygaavntakvtpgstcavfglggvgfsaivgckaagasriigvgt hkdkfpkaielgateclnpkdydkpiyevicektnggvdyavecagrietmmnalqstyc gsgvtvvlglaspnerlpldplllltgrslkgsvfggfkgeevsrlvddymkkk
Timeline for d1p0cb2: