Lineage for d1oztn_ (1ozt N:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936733Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 936734Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 936747Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 936845Species Human (Homo sapiens) [TaxId:9606] [49333] (55 PDB entries)
  8. 937041Domain d1oztn_: 1ozt N: [87629]
    mutant

Details for d1oztn_

PDB Entry: 1ozt (more details), 2.5 Å

PDB Description: crystal structure of apo-h46r familial als mutant human cu,zn superoxide dismutase (cuznsod) to 2.5a resolution
PDB Compounds: (N:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d1oztn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oztn_ b.1.8.1 (N:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOPe Domain Coordinates for d1oztn_:

Click to download the PDB-style file with coordinates for d1oztn_.
(The format of our PDB-style files is described here.)

Timeline for d1oztn_: