Lineage for d1oynb_ (1oyn B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 285622Fold a.125: PDEase [48546] (1 superfamily)
    multihelical; can be divided into three subdomains
  4. 285623Superfamily a.125.1: PDEase [48547] (1 family) (S)
  5. 285624Family a.125.1.1: PDEase [48548] (2 proteins)
    3',5'-cyclic-nucleotide phosphodiesterase, PF00233
  6. 285629Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 285630Species Human (Homo sapiens) [TaxId:9606] [89152] (3 PDB entries)
  8. 285632Domain d1oynb_: 1oyn B: [87610]

Details for d1oynb_

PDB Entry: 1oyn (more details), 2 Å

PDB Description: Crystal structure of PDE4D2 in complex with (R,S)-rolipram

SCOP Domain Sequences for d1oynb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oynb_ a.125.1.1 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens)}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstipq

SCOP Domain Coordinates for d1oynb_:

Click to download the PDB-style file with coordinates for d1oynb_.
(The format of our PDB-style files is described here.)

Timeline for d1oynb_: