Class a: All alpha proteins [46456] (179 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins) |
Protein Class tau GST [81354] (2 species) |
Species Rice (Oryza sativa) [TaxId:4530] [89062] (1 PDB entry) |
Domain d1oyjc1: 1oyj C:86-229 [87601] Other proteins in same PDB: d1oyja2, d1oyjb2, d1oyjc2, d1oyjd2 |
PDB Entry: 1oyj (more details), 1.95 Å
SCOP Domain Sequences for d1oyjc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oyjc1 a.45.1.1 (C:86-229) Class tau GST {Rice (Oryza sativa)} llppansgdadaayaratarfwadyvdrklydcgsrlwrlkgepqaaagremaeilrtle aelgdreffggggggrlgfvdvalvpftawfysyercggfsveevaprlaawarrcgrid svvkhlpspekvydfvgvlkkkyg
Timeline for d1oyjc1: