SCOP 1.65: Domain d1oyjc1: 1oyj C:86-229

Lineage for d1oyjc1 (1oyj C:86-229)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)

6. Protein Class tau GST [81354] (2 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [89062] (1 PDB entry)

8. Domain d1oyjc1: 1oyj C:86-229 [87601]
   Other proteins in same PDB: d1oyja2, d1oyjb2, d1oyjc2, d1oyjd2

Details for d1oyjc1

PDB Entry: 1oyj, 1.95 Å

PDB Description: Crystal structure solution of Rice GST1 (OsGSTU1) in complex with glutathione.

SCOP Domain Sequences for d1oyjc1:

Sequence; same for both SEQRES and ATOM records:

>d1oyjc1 a.45.1.1 (C:86-229) Class tau GST {Rice (Oryza sativa)}
llppansgdadaayaratarfwadyvdrklydcgsrlwrlkgepqaaagremaeilrtle
aelgdreffggggggrlgfvdvalvpftawfysyercggfsveevaprlaawarrcgrid
svvkhlpspekvydfvgvlkkkyg

Timeline for d1oyjc1:

• d1oyjc1 is new in SCOP 1.65
  
• d1oyjc1 appears in SCOP 1.67
  
• d1oyjc1 appears in the current release, SCOPe 2.08