SCOP 1.69: Domain d1oyja2: 1oyj A:2-85

Lineage for d1oyja2 (1oyj A:2-85)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (15 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class tau GST [81365] (2 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [89706] (1 PDB entry)

8. Domain d1oyja2: 1oyj A:2-85 [87598]
   Other proteins in same PDB: d1oyja1, d1oyjb1, d1oyjc1, d1oyjd1

Details for d1oyja2

PDB Entry: 1oyj, 1.95 Å

PDB Description: Crystal structure solution of Rice GST1 (OsGSTU1) in complex with glutathione.

SCOP Domain Sequences for d1oyja2:

Sequence; same for both SEQRES and ATOM records:

>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa)}
aeekelvlldfwvspfgqrcriamaekglefeyreedlgnksdlllrsnpvhrkipvllh
agrpvseslvilqylddafpgtph

Timeline for d1oyja2:

• d1oyja2 first appeared in SCOP 1.65
  
• d1oyja2 appears in SCOP 1.67
  
• d1oyja2 appears in SCOP 1.71
  
• d1oyja2 appears in the current release, SCOPe 2.08