Class b: All beta proteins [48724] (165 folds) |
Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (3 families) |
Family b.40.6.3: ABC-transporter additional domain [50338] (3 proteins) probably stems out from the biMOP domain |
Protein Glucose transport protein GlcV, N-terminal domain [89335] (1 species) |
Species Archaeon Sulfolobus solfataricus [TaxId:2287] [89336] (5 PDB entries) |
Domain d1oxuc1: 1oxu C:243-353 [87531] Other proteins in same PDB: d1oxua2, d1oxub2, d1oxuc2 complexed with adp, iod, mg |
PDB Entry: 1oxu (more details), 2.1 Å
SCOP Domain Sequences for d1oxuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oxuc1 b.40.6.3 (C:243-353) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} einelegkvtnegvvigslrfpvsvssdraiigirpedvklskdvikddswilvgkgkvk vigyqgglfrititpldseeeiftysdhpihsgeevlvyvrkdkikvfekn
Timeline for d1oxuc1:
View in 3D Domains from other chains: (mouse over for more information) d1oxua1, d1oxua2, d1oxub1, d1oxub2 |