SCOPe 2.08: Domain d1oxha2: 1oxh A:252-409

Lineage for d1oxha2 (1oxh A:252-409)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Beta-ketoacyl-ACP synthase II, C-terminal domain [419017] (6 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [419491] (4 PDB entries)

8. Domain d1oxha2: 1oxh A:252-409 [87510]
   Other proteins in same PDB: d1oxha1, d1oxhb1, d1oxhc1, d1oxhd1
   complexed with mg

Details for d1oxha2

PDB Entry: 1oxh, 2.09 Å

PDB Description: the crystal structure of beta-ketoacyl-[acyl carrier protein] synthase ii from streptococcus pneumoniae, triclinic form

PDB Compounds: (A:) Beta ketoacyl-acyl carrier protein synthase

SCOPe Domain Sequences for d1oxha2:

Sequence; same for both SEQRES and ATOM records:

>d1oxha2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II, C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqvayvnahgtstpane
kgesgaivavlgkevpvsstksftghllgaagaveaivtieamrhnfvpmtagtsevsdy
ieanvvygqglekeipyaisntfgfgghnavlafkrwe

Timeline for d1oxha2:

• d1oxha2 first appeared in SCOP 1.65
  
• d1oxha2 appears in SCOPe 2.07