Lineage for d1oxha1 (1oxh A:2-251)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495246Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 495247Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 495248Family c.95.1.1: Thiolase-related [53902] (7 proteins)
  6. 495359Protein Beta-ketoacyl-ACP synthase II [53909] (4 species)
  7. 495365Species Streptococcus pneumoniae [TaxId:1313] [89793] (2 PDB entries)
  8. 495368Domain d1oxha1: 1oxh A:2-251 [87509]

Details for d1oxha1

PDB Entry: 1oxh (more details), 2.09 Å

PDB Description: the crystal structure of beta-ketoacyl-[acyl carrier protein] synthase ii from streptococcus pneumoniae, triclinic form

SCOP Domain Sequences for d1oxha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxha1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae}
klnrvvvtgygvtspigntpeefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfdk
yfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrfgvivasgiggikeiedqvlr
lhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikfg
fqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvle
slehaekrga

SCOP Domain Coordinates for d1oxha1:

Click to download the PDB-style file with coordinates for d1oxha1.
(The format of our PDB-style files is described here.)

Timeline for d1oxha1: