Lineage for d1ox0a1 (1ox0 A:1-251)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2164459Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2164634Protein Beta-ketoacyl-ACP synthase II [53909] (6 species)
  7. 2164644Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [89793] (4 PDB entries)
  8. 2164645Domain d1ox0a1: 1ox0 A:1-251 [87495]
    Other proteins in same PDB: d1ox0a3
    complexed with mg

Details for d1ox0a1

PDB Entry: 1ox0 (more details), 1.3 Å

PDB Description: the crystal structure of beta-ketoacyl-[acyl carrier protein] synthase ii from streptococcus pneumoniae
PDB Compounds: (A:) Beta ketoacyl-acyl carrier protein synthase

SCOPe Domain Sequences for d1ox0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ox0a1 c.95.1.1 (A:1-251) Beta-ketoacyl-ACP synthase II {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mklnrvvvtgygvtspigntpeefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfd
kyfvkkdtnrfdnyslyalyaaqeavnhanldvealnrdrfgvivasgiggikeiedqvl
rlhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikf
gfqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvl
eslehaekrga

SCOPe Domain Coordinates for d1ox0a1:

Click to download the PDB-style file with coordinates for d1ox0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ox0a1: