Class a: All alpha proteins [46456] (179 folds) |
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families) dimer of identical subunits |
Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins) |
Protein Integration host factor beta subunit (IHFB) [88880] (1 species) heterodimer of two related subunits |
Species Escherichia coli [TaxId:562] [88881] (4 PDB entries) |
Domain d1owfb_: 1owf B: [87488] Other proteins in same PDB: d1owfa_ mutant |
PDB Entry: 1owf (more details), 1.95 Å
SCOP Domain Sequences for d1owfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1owfb_ a.55.1.1 (B:) Integration host factor beta subunit (IHFB) {Escherichia coli} mtkselierlatqqshipaktvedavkemlehmastlaqgeriairgfgsfslhyraprt grnpktgdkvelegkyvphfkpgkelrdraniyg
Timeline for d1owfb_: