Lineage for d1ow3a_ (1ow3 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542636Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 542637Superfamily a.116.1: GTPase activation domain, GAP [48350] (2 families) (S)
  5. 542638Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (5 proteins)
    Pfam 00620
  6. 542649Protein p50 RhoGAP domain [48352] (1 species)
  7. 542650Species Human (Homo sapiens) [TaxId:9606] [48353] (4 PDB entries)
  8. 542652Domain d1ow3a_: 1ow3 A: [87485]
    Other proteins in same PDB: d1ow3b_
    complexed with gdp, mg, mgf

Details for d1ow3a_

PDB Entry: 1ow3 (more details), 1.8 Å

PDB Description: crystal structure of rhoa.gdp.mgf3-in complex with rhogap

SCOP Domain Sequences for d1ow3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ow3a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens)}
plpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvrevqq
kynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlq
vlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainp
intftkflldhqgelf

SCOP Domain Coordinates for d1ow3a_:

Click to download the PDB-style file with coordinates for d1ow3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ow3a_: